PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400002598
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 452aa    MW: 50162.7 Da    PI: 6.5664
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400002598genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.81.4e-30209264359
                           -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           DgynWrKYGqK+vk se+prsYY+Ct+ +C vkkkvers  d++++eitY+g+Hnh+
  PGSC0003DMP400002598 209 DGYNWRKYGQKKVKASECPRSYYKCTHLKCLVKKKVERSV-DGHITEITYNGRHNHD 264
                           9***************************************.***************7 PP

2WRKY104.17.5e-33377435159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vkg+++prsYYrCt++gC+v+k+ver+++dpk+v++tY g+Hnh+
  PGSC0003DMP400002598 377 LDDGYKWRKYGQKVVKGTQHPRSYYRCTYPGCNVRKQVERASTDPKAVITTYDGKHNHD 435
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-26204266IPR003657WRKY domain
SuperFamilySSF1182901.57E-23206266IPR003657WRKY domain
SMARTSM007748.0E-33207265IPR003657WRKY domain
PROSITE profilePS5081122.768209266IPR003657WRKY domain
PfamPF031062.7E-22209264IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-35363437IPR003657WRKY domain
SuperFamilySSF1182903.01E-29369437IPR003657WRKY domain
PROSITE profilePS5081135.37372437IPR003657WRKY domain
SMARTSM007742.7E-38377436IPR003657WRKY domain
PfamPF031067.9E-26378435IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MGETGEASAI SFPSLTIPPR PSFESFFNMS SFSPGPMSLV SSFLSDQSPD SADCPPSFSQ  60
LLAGYEYSGD LAGCQNNSVY NPVNPQLFMI PSGLSPSGFL NSPGFLSPLQ SPFGMSHQQA  120
LAHVTAQAEF SSSYMQAEDQ CSSQVASVEA LGHELSIDPN EFSLQIKECL RTSLDNKPSD  180
NQGKQFEQPE VSQSENKTSF GALDKPACDG YNWRKYGQKK VKASECPRSY YKCTHLKCLV  240
KKKVERSVDG HITEITYNGR HNHDQPTKQR KNGSALDNTD CFGVRPDIST HDWTVMNSSD  300
GYSPSRSDQV PTQMASELLV KRECDETESY LIDVDDEGHD EPDAKRMKTA VMPVASSHVT  360
VAESKIVLQT RSEVDFLDDG YKWRKYGQKV VKGTQHPRSY YRCTYPGCNV RKQVERASTD  420
PKAVITTYDG KHNHDIPTVR NRGTRNKYSQ R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-35209437877Probable WRKY transcription factor 4
2lex_A3e-35209437877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111270.0AB711127.1 Solanum tuberosum StWRKY15 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001305593.10.0probable WRKY transcription factor 3
TrEMBLM0ZM200.0M0ZM20_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000036370.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43142344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-103WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]